PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G031900.1.p
Common NameSb09g002675, SORBIDRAFT_09g002675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 407aa    MW: 43682.4 Da    PI: 5.3663
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G031900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569e-1866113148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+WT +Ed llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Sobic.009G031900.1.p  66 RGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 113
                           89********************************************97 PP

2Myb_DNA-binding53.27e-17119162146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T+eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Sobic.009G031900.1.p 119 RGNITAEEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 162
                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.18361113IPR017930Myb domain
SuperFamilySSF466892.55E-3063160IPR009057Homeodomain-like
SMARTSM007178.7E-1565115IPR001005SANT/Myb domain
PfamPF002496.2E-1666113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2267120IPR009057Homeodomain-like
CDDcd001675.75E-1268113No hitNo description
PROSITE profilePS5129423.447114168IPR017930Myb domain
SMARTSM007175.2E-15118166IPR001005SANT/Myb domain
PfamPF002494.0E-15119162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-23121166IPR009057Homeodomain-like
CDDcd001672.62E-12123162No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MDMPMAMVSF DEDLDQMLLA TISPAGSSAT SSSAPAAAAA PPPVVAGSSS DDDEAAAVAV  60
GADLRRGPWT VDEDILLVNY IAAHGEGRWN SLARSAGLKR TGKSCRLRWL NYLRPDVRRG  120
NITAEEQLLI LDLHSRWGNR WSKIAQHLPG RTDNEIKNYW RTRVQKHARH LRCDVNSAGF  180
RHVVRHVWMP RLRERVQAAA GRDDQMVATA GSGCGGVQQQ QQQQAAPAAS LAAVVQAPAA  240
TSTASAPPAY CYDYYGRQHL VEQQQQGDHH GVPPAPSEAH RRRQYYSETA AGQTAAATAL  300
SPDDASSALR VPSTFTADDA STHYAAAYTS VAMATSTNDQ GCGPTTIEDE VLAGTTWSEL  360
LATVTGGPHD DSSSMDMIGL PEFGFGDLED RDGLWSLDDL CLQQLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-266316624126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277110.0KJ727711.1 Zea mays clone pUT5650 MYB transcription factor (MYB101) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440534.10.0hypothetical protein SORBIDRAFT_09g002675, partial
TrEMBLC5YZH80.0C5YZH8_SORBI; Putative uncharacterized protein Sb09g002675 (Fragment)
STRINGSb09g002675.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP1558624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-77myb domain protein 112